Lineage for d5acbb2 (5acb B:158-267)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326510Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2326511Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2326512Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2326968Protein automated matches [227027] (3 species)
    not a true protein
  7. 2326982Species Human (Homo sapiens) [TaxId:9606] [225840] (13 PDB entries)
  8. 2327008Domain d5acbb2: 5acb B:158-267 [318453]
    Other proteins in same PDB: d5acbc_, d5acbd_
    automated match to d2i53a2
    complexed with 5i1

Details for d5acbb2

PDB Entry: 5acb (more details), 2.7 Å

PDB Description: crystal structure of the human cdk12-cyclink complex
PDB Compounds: (B:) cyclin-k

SCOPe Domain Sequences for d5acbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5acbb2 a.74.1.1 (B:158-267) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqgkqqmph

SCOPe Domain Coordinates for d5acbb2:

Click to download the PDB-style file with coordinates for d5acbb2.
(The format of our PDB-style files is described here.)

Timeline for d5acbb2: