Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein automated matches [227027] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225840] (10 PDB entries) |
Domain d5acba1: 5acb A:20-157 [318434] Other proteins in same PDB: d5acbc_, d5acbd_ automated match to d2i53a1 complexed with 5i1 |
PDB Entry: 5acb (more details), 2.7 Å
SCOPe Domain Sequences for d5acba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5acba1 a.74.1.1 (A:20-157) automated matches {Human (Homo sapiens) [TaxId: 9606]} tkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfh rfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkee vmvlerillqtikfdlqv
Timeline for d5acba1:
View in 3D Domains from other chains: (mouse over for more information) d5acbb1, d5acbb2, d5acbc_, d5acbd_ |