| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
| Protein Pyruvate oxidase [88754] (2 species) |
| Species Lactobacillus plantarum [TaxId:1590] [88755] (2 PDB entries) |
| Domain d1poxa3: 1pox A:366-593 [31794] Other proteins in same PDB: d1poxa1, d1poxa2, d1poxb1, d1poxb2 complexed with fad, gol, mg, na, tpp; mutant |
PDB Entry: 1pox (more details), 2.1 Å
SCOPe Domain Sequences for d1poxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1poxa3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlvtqvqyhlpvinvvftncqygfikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
Timeline for d1poxa3: