Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [316344] (2 PDB entries) |
Domain d4zxfa_: 4zxf A: [317848] automated match to d3hjua_ complexed with 4s7, no3, so4 |
PDB Entry: 4zxf (more details), 2.5 Å
SCOPe Domain Sequences for d4zxfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zxfa_ c.69.1.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} apypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlmd hlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmwg hsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvrid tgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakdk pviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmkq wldkhttt
Timeline for d4zxfa_: