Lineage for d4zxfd_ (4zxf D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153463Species Saccharomyces cerevisiae [TaxId:559292] [316344] (2 PDB entries)
  8. 2153471Domain d4zxfd_: 4zxf D: [317870]
    automated match to d3hjua_
    complexed with 4s7, no3, so4

Details for d4zxfd_

PDB Entry: 4zxf (more details), 2.5 Å

PDB Description: crystal structure of a soluble variant of monoglyceride lipase from saccharomyces cerevisiae in complex with a substrate analog
PDB Compounds: (D:) Monoglyceride lipase

SCOPe Domain Sequences for d4zxfd_:

Sequence, based on SEQRES records: (download)

>d4zxfd_ c.69.1.0 (D:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
pypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlmdh
lslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmwgh
smgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvridt
gldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakdkp
viimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmkqw
ldkht

Sequence, based on observed residues (ATOM records): (download)

>d4zxfd_ c.69.1.0 (D:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
pypykvqttvpelqyenfdgakfgymfwpvqngtrgrvllihgfgeytkiqfrlmdhlsl
ngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknplfmwghsmgggiclnyac
qgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvridtgldlkgitsdka
yraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakdkpviimhgqddtin
dpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmkqwldkht

SCOPe Domain Coordinates for d4zxfd_:

Click to download the PDB-style file with coordinates for d4zxfd_.
(The format of our PDB-style files is described here.)

Timeline for d4zxfd_: