PDB entry 4zxf

View 4zxf on RCSB PDB site
Description: Crystal Structure of a Soluble Variant of Monoglyceride Lipase from Saccharomyces Cerevisiae in Complex with a Substrate Analog
Class: hydrolase
Keywords: Hydrolase, Monoglyceride Lipase, Monoacylglycerol Lipase, Complex, Substrate Analog
Deposited on 2015-05-20, released 2016-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoglyceride lipase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YJU3, YKL094W, YKL441
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28321
      • engineered mutation (201)
      • engineered mutation (290)
    Domains in SCOPe 2.06: d4zxfa_
  • Chain 'B':
    Compound: Monoglyceride lipase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YJU3, YKL094W, YKL441
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28321 (27-End)
      • engineered mutation (201)
      • engineered mutation (290)
    Domains in SCOPe 2.06: d4zxfb_
  • Chain 'C':
    Compound: Monoglyceride lipase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YJU3, YKL094W, YKL441
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28321 (27-End)
      • engineered mutation (201)
      • engineered mutation (290)
    Domains in SCOPe 2.06: d4zxfc_
  • Chain 'D':
    Compound: Monoglyceride lipase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YJU3, YKL094W, YKL441
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28321
      • engineered mutation (201)
      • engineered mutation (290)
    Domains in SCOPe 2.06: d4zxfd_
  • Heterogens: SO4, 4S7, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zxfA (A:)
    msyyhhhhhhdydipttenlyfqgamgmapypykvqttvpelqyenfdgakfgymfwpvq
    ngtnevrgrvllihgfgeytkiqfrlmdhlslngyesftfdqrgagvtspgrskgvtdey
    hvfndlehfveknlseckakgiplfmwghsmgggiclnyacqgkhkneisgyigsgplii
    lhphtmynkptqiiapllakfsprvridtgldlkgitsdkayraflgsdpmsvplygsfr
    qihdfmqrgaklyknennyiqknfakdkpviimhgqddtindpkgsekfirdcpsadkel
    klypgarhsifsletdkvfntvfndmkqwldkhttteakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zxfA (A:)
    apypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlmd
    hlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmwg
    hsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvrid
    tgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakdk
    pviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmkq
    wldkhttt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zxfB (B:)
    msyyhhhhhhdydipttenlyfqgamgmapypykvqttvpelqyenfdgakfgymfwpvq
    ngtnevrgrvllihgfgeytkiqfrlmdhlslngyesftfdqrgagvtspgrskgvtdey
    hvfndlehfveknlseckakgiplfmwghsmgggiclnyacqgkhkneisgyigsgplii
    lhphtmynkptqiiapllakfsprvridtgldlkgitsdkayraflgsdpmsvplygsfr
    qihdfmqrgaklyknennyiqknfakdkpviimhgqddtindpkgsekfirdcpsadkel
    klypgarhsifsletdkvfntvfndmkqwldkhttteakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zxfB (B:)
    mapypykvqttvpelqyenfdgakfgymfwpvqngvrgrvllihgfgeytkiqfrlmdhl
    slngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmwghs
    mgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvridtg
    ldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakdkpv
    iimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmkqwl
    dkhttte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zxfC (C:)
    msyyhhhhhhdydipttenlyfqgamgmapypykvqttvpelqyenfdgakfgymfwpvq
    ngtnevrgrvllihgfgeytkiqfrlmdhlslngyesftfdqrgagvtspgrskgvtdey
    hvfndlehfveknlseckakgiplfmwghsmgggiclnyacqgkhkneisgyigsgplii
    lhphtmynkptqiiapllakfsprvridtgldlkgitsdkayraflgsdpmsvplygsfr
    qihdfmqrgaklyknennyiqknfakdkpviimhgqddtindpkgsekfirdcpsadkel
    klypgarhsifsletdkvfntvfndmkqwldkhttteakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zxfC (C:)
    mapypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlm
    dhlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmw
    ghsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvri
    dtgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakd
    kpviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmk
    qwldkht
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zxfD (D:)
    msyyhhhhhhdydipttenlyfqgamgmapypykvqttvpelqyenfdgakfgymfwpvq
    ngtnevrgrvllihgfgeytkiqfrlmdhlslngyesftfdqrgagvtspgrskgvtdey
    hvfndlehfveknlseckakgiplfmwghsmgggiclnyacqgkhkneisgyigsgplii
    lhphtmynkptqiiapllakfsprvridtgldlkgitsdkayraflgsdpmsvplygsfr
    qihdfmqrgaklyknennyiqknfakdkpviimhgqddtindpkgsekfirdcpsadkel
    klypgarhsifsletdkvfntvfndmkqwldkhttteakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zxfD (D:)
    pypykvqttvpelqyenfdgakfgymfwpvqngtrgrvllihgfgeytkiqfrlmdhlsl
    ngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknplfmwghsmgggiclnyac
    qgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvridtgldlkgitsdka
    yraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakdkpviimhgqddtin
    dpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmkqwldkht