SCOP 1.61: Domain d2hgsa1: 2hgs A:202-303

Lineage for d2hgsa1 (2hgs A:202-303)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.4: Eukaryotic glutathione synthetase [52460] (1 protein)

6. Protein Eukaryotic glutathione synthetase [52461] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52462] (1 PDB entry)

8. Domain d2hgsa1: 2hgs A:202-303 [31722]
   Other proteins in same PDB: d2hgsa2, d2hgsa3

Details for d2hgsa1

PDB Entry: 2hgs, 2.1 Å

PDB Description: human glutathione synthetase

SCOP Domain Sequences for d2hgsa1:

Sequence; same for both SEQRES and ATOM records:

>d2hgsa1 c.30.1.4 (A:202-303) Eukaryotic glutathione synthetase {Human (Homo sapiens)}
pnalvlliaqekernifdqraienellarnihvirrtfedisekgsldqdrrlfvdgqei
avvyfrdgymprqyslqnwearlllershaakcpdiatqlag

Timeline for d2hgsa1:

• d2hgsa1 first appeared (with stable ids) in SCOP 1.55
  
• d2hgsa1 appears in SCOP 1.59
  
• d2hgsa1 appears in SCOP 1.63
  
• d2hgsa1 appears in the current release, SCOPe 2.08