Lineage for d5ijzc1 (5ijz C:1-197)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890689Species Corynebacterium glutamicum [TaxId:196627] [315004] (1 PDB entry)
  8. 2890692Domain d5ijzc1: 5ijz C:1-197 [315623]
    Other proteins in same PDB: d5ijza2, d5ijzb2, d5ijzc2, d5ijzd2, d5ijze2, d5ijzf2, d5ijzg2, d5ijzh2, d5ijzi2, d5ijzj2, d5ijzk2, d5ijzl2
    automated match to d4bhta1
    complexed with akg, nap

Details for d5ijzc1

PDB Entry: 5ijz (more details), 2.29 Å

PDB Description: crystal structure of glutamate dehydrogenase(gdh) from corynebacterium glutamicum
PDB Compounds: (C:) NADP-specific glutamate dehydrogenase

SCOPe Domain Sequences for d5ijzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ijzc1 c.58.1.0 (C:1-197) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
ghyrrmanqhesgvltg

SCOPe Domain Coordinates for d5ijzc1:

Click to download the PDB-style file with coordinates for d5ijzc1.
(The format of our PDB-style files is described here.)

Timeline for d5ijzc1: