Lineage for d5ijzk2 (5ijz K:198-447)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846658Species Corynebacterium glutamicum [TaxId:196627] [315006] (3 PDB entries)
  8. 2846671Domain d5ijzk2: 5ijz K:198-447 [344275]
    Other proteins in same PDB: d5ijza1, d5ijzb1, d5ijzc1, d5ijzd1, d5ijze1, d5ijzf1, d5ijzg1, d5ijzh1, d5ijzi1, d5ijzj1, d5ijzk1, d5ijzl1
    complexed with akg, nap

Details for d5ijzk2

PDB Entry: 5ijz (more details), 2.29 Å

PDB Description: crystal structure of glutamate dehydrogenase(gdh) from corynebacterium glutamicum
PDB Compounds: (K:) NADP-specific glutamate dehydrogenase

SCOPe Domain Sequences for d5ijzk2:

Sequence, based on SEQRES records: (download)

>d5ijzk2 c.2.1.0 (K:198-447) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
kgltwggslvrteatgygcvyfvsemikakgesisgqkiivsgsgnvatyaiekaqelga
tvigfsdssgwvhtpngvdvaklreikevrrarvsvyadevegatyhtdgsiwdlkcdia
lpcatqnelngenaktladngcrfvaeganmpstpeavevfrerdirfgpgkaanaggva
tsalemqqnasrdswsfeytderlqvimknifktcaetaaeyghendyvvganiagfkkv
adamlaqgvi

Sequence, based on observed residues (ATOM records): (download)

>d5ijzk2 c.2.1.0 (K:198-447) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
kgltwggslvrteatgygcvyfvsemikakgpgkaanaggvatsalemqqnasrdswsfe
ytderlqvimknifktcaetaaeygvvganiagfkkvadamlaqgvi

SCOPe Domain Coordinates for d5ijzk2:

Click to download the PDB-style file with coordinates for d5ijzk2.
(The format of our PDB-style files is described here.)

Timeline for d5ijzk2: