Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:196627] [315006] (3 PDB entries) |
Domain d5ijzh2: 5ijz H:198-447 [315518] Other proteins in same PDB: d5ijza1, d5ijzb1, d5ijzc1, d5ijzd1, d5ijze1, d5ijzf1, d5ijzg1, d5ijzh1, d5ijzi1, d5ijzj1, d5ijzk1, d5ijzl1 automated match to d4bhta2 complexed with akg, nap |
PDB Entry: 5ijz (more details), 2.29 Å
SCOPe Domain Sequences for d5ijzh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ijzh2 c.2.1.0 (H:198-447) automated matches {Corynebacterium glutamicum [TaxId: 196627]} kgltwggslvrteatgygcvyfvsemikakgesisgqkiivsgsgnvatyaiekaqelga tvigfsdssgwvhtpngvdvaklreikevrrarvsvyadevegatyhtdgsiwdlkcdia lpcatqnelngenaktladngcrfvaeganmpstpeavevfrerdirfgpgkaanaggva tsalemqqnasrdswsfeytderlqvimknifktcaetaaeyghendyvvganiagfkkv adamlaqgvi
Timeline for d5ijzh2: