Lineage for d5fggt_ (5fgg T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994463Domain d5fggt_: 5fgg T: [314307]
    Other proteins in same PDB: d5fgga_, d5fggc2, d5fgge_, d5fggg_, d5fggi_, d5fggj_, d5fggk_, d5fggl_, d5fggn_, d5fggo_, d5fggq2, d5fggs_, d5fggu_, d5fggw_, d5fggx_, d5fggy_, d5fggz_
    automated match to d4g4sg_
    complexed with 3bv, cl, mes, mg; mutant

Details for d5fggt_

PDB Entry: 5fgg (more details), 2.7 Å

PDB Description: yeast 20s proteasome beta5-l(-49s)_d17n double mutant in complex with carfilzomib
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5fggt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fggt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5fggt_:

Click to download the PDB-style file with coordinates for d5fggt_.
(The format of our PDB-style files is described here.)

Timeline for d5fggt_: