Lineage for d4g4sg_ (4g4s G:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2201421Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2202407Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2202408Domain d4g4sg_: 4g4s G: [240145]
    Other proteins in same PDB: d4g4sa_, d4g4sb_, d4g4sc_, d4g4sd_, d4g4se_, d4g4sh_, d4g4si_, d4g4sj_, d4g4sk_, d4g4sm_, d4g4sn_
    automated match to d1irug_
    complexed with ldz, mg

Details for d4g4sg_

PDB Entry: 4g4s (more details), 2.49 Å

PDB Description: Structure of Proteasome-Pba1-Pba2 Complex
PDB Compounds: (G:) Proteasome component C1

SCOPe Domain Sequences for d4g4sg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g4sg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mtsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllv
pqknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyv
qahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklv
dhhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeai
dfaqke

SCOPe Domain Coordinates for d4g4sg_:

Click to download the PDB-style file with coordinates for d4g4sg_.
(The format of our PDB-style files is described here.)

Timeline for d4g4sg_: