Lineage for d5cz6d_ (5cz6 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994384Domain d5cz6d_: 5cz6 D: [314132]
    Other proteins in same PDB: d5cz6a_, d5cz6c2, d5cz6e_, d5cz6g_, d5cz6i_, d5cz6j_, d5cz6k_, d5cz6l_, d5cz6n_, d5cz6o_, d5cz6q2, d5cz6s_, d5cz6u_, d5cz6w_, d5cz6x_, d5cz6y_, d5cz6z_
    automated match to d1rype_
    complexed with cl, mg, srg; mutant

Details for d5cz6d_

PDB Entry: 5cz6 (more details), 2.7 Å

PDB Description: yeast 20s proteasome beta5-t1a mutant in complex with syringolin a, propeptide expressed in trans
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5cz6d_:

Sequence, based on SEQRES records: (download)

>d5cz6d_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5cz6d_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5cz6d_:

Click to download the PDB-style file with coordinates for d5cz6d_.
(The format of our PDB-style files is described here.)

Timeline for d5cz6d_: