Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5cz6h_: 5cz6 H: [312975] Other proteins in same PDB: d5cz6a_, d5cz6c2, d5cz6e_, d5cz6g_, d5cz6i_, d5cz6j_, d5cz6k_, d5cz6l_, d5cz6n_, d5cz6o_, d5cz6q2, d5cz6s_, d5cz6u_, d5cz6w_, d5cz6x_, d5cz6y_, d5cz6z_ automated match to d4r17h_ complexed with cl, mg, srg; mutant |
PDB Entry: 5cz6 (more details), 2.7 Å
SCOPe Domain Sequences for d5cz6h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cz6h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5cz6h_:
View in 3D Domains from other chains: (mouse over for more information) d5cz6a_, d5cz6b_, d5cz6c1, d5cz6c2, d5cz6d_, d5cz6e_, d5cz6f_, d5cz6g_, d5cz6i_, d5cz6j_, d5cz6k_, d5cz6l_, d5cz6m_, d5cz6n_, d5cz6o_, d5cz6p_, d5cz6q1, d5cz6q2, d5cz6r_, d5cz6s_, d5cz6t_, d5cz6u_, d5cz6v_, d5cz6w_, d5cz6x_, d5cz6y_, d5cz6z_ |