Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (21 species) not a true protein |
Species Campylobacter jejuni [TaxId:195099] [311910] (3 PDB entries) |
Domain d4yb7f2: 4yb7 F:225-299 [311913] Other proteins in same PDB: d4yb7a1, d4yb7b1, d4yb7c1, d4yb7d1, d4yb7e1, d4yb7f1, d4yb7g1, d4yb7h1, d4yb7i1, d4yb7j1, d4yb7k1, d4yb7l1 automated match to d1h3da2 complexed with acy, atp, mg, po4 |
PDB Entry: 4yb7 (more details), 2.2 Å
SCOPe Domain Sequences for d4yb7f2:
Sequence, based on SEQRES records: (download)
>d4yb7f2 d.58.5.0 (F:225-299) automated matches {Campylobacter jejuni [TaxId: 195099]} eskyimlhapkekldkiqallpgverptilplahdeknvalhmvskenlfwetmealkee gassilvlpiekmlk
>d4yb7f2 d.58.5.0 (F:225-299) automated matches {Campylobacter jejuni [TaxId: 195099]} eskyimlhapkekldkiqallpgverptilpleknvalhmvskenlfwetmealkeegas silvlpiekmlk
Timeline for d4yb7f2: