SCOPe 2.08: Domain d4yb7b2: 4yb7 B:225-299

Lineage for d4yb7b2 (4yb7 B:225-299)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:195099] [311910] (3 PDB entries)

8. Domain d4yb7b2: 4yb7 B:225-299 [311918]
   Other proteins in same PDB: d4yb7a1, d4yb7b1, d4yb7c1, d4yb7d1, d4yb7e1, d4yb7f1, d4yb7g1, d4yb7h1, d4yb7i1, d4yb7j1, d4yb7k1, d4yb7l1
   automated match to d1h3da2
   complexed with acy, atp, mg, po4

Details for d4yb7b2

PDB Entry: 4yb7, 2.2 Å

PDB Description: adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp

PDB Compounds: (B:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d4yb7b2:

Sequence; same for both SEQRES and ATOM records:

>d4yb7b2 d.58.5.0 (B:225-299) automated matches {Campylobacter jejuni [TaxId: 195099]}
eskyimlhapkekldkiqallpgverptilplahdeknvalhmvskenlfwetmealkee
gassilvlpiekmlk

Timeline for d4yb7b2:

• d4yb7b2 first appeared in SCOPe 2.06
  
• d4yb7b2 appears in SCOPe 2.07