Lineage for d1h3da2 (1h3d A:225-299)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.5: GlnB-like [54913] (6 families) 
form timeric structures with the orthogonally packed beta-sheets
Family d.58.5.3: ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [88851] (1 protein)
automatically mapped to Pfam PF08029Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [82669] (2 species)
binds allosteric inhibitor histidine
Species Escherichia coli [TaxId:562] [102977] (2 PDB entries) 
Domain d1h3da2: 1h3d A:225-299 [90593]
Other proteins in same PDB: d1h3da1
complexed with amp, tla
Details for d1h3da2
PDB Entry: 1h3d (more details), 2.7 Å
PDB Description: structure of the e.coli atp-phosphoribosyltransferase
PDB Compounds: (A:) ATP-phosphoribosyltransferaseSCOPe Domain Sequences for d1h3da2:
Sequence, based on SEQRES records: (download)
>d1h3da2 d.58.5.3 (A:225-299) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Escherichia coli [TaxId: 562]}
eskyimmhapterldeviallpgaerptilplagdqqrvamhmvssetlfwetmeklkal
gassilvlpiekmme
Sequence, based on observed residues (ATOM records): (download)
>d1h3da2 d.58.5.3 (A:225-299) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Escherichia coli [TaxId: 562]}
eskyimmhapterldeviallpgaerptilplamhmvssetlfwetmeklkalgassilv
lpiekmme
SCOPe Domain Coordinates for d1h3da2:
Click to download the PDB-style file with coordinates for d1h3da2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h3da2:
- d1h3da2 first appeared in SCOP 1.67
- d1h3da2 appears in SCOPe 2.07
View in 3D
