Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
Protein automated matches [191276] (4 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:1402521] [311540] (1 PDB entry) |
Domain d4wvzc1: 4wvz C:4-201 [311571] Other proteins in same PDB: d4wvzc2, d4wvzd2 automated match to d4tlfd_ complexed with fe2 |
PDB Entry: 4wvz (more details), 2.09 Å
SCOPe Domain Sequences for d4wvzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wvzc1 b.82.1.19 (C:4-201) automated matches {Pseudomonas aeruginosa [TaxId: 1402521]} ilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqqy llhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphpsgar rrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfisg ysnsrlpniwdlskenpa
Timeline for d4wvzc1:
View in 3D Domains from other chains: (mouse over for more information) d4wvza_, d4wvzb_, d4wvzd1, d4wvzd2 |