SCOPe 2.07: Domain d4wvzc1: 4wvz C:4-201

Lineage for d4wvzc1 (4wvz C:4-201)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
   Pfam PF05995, CDO_I

6. Protein automated matches [191276] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:1402521] [311540] (1 PDB entry)

8. Domain d4wvzc1: 4wvz C:4-201 [311571]
   Other proteins in same PDB: d4wvzc2, d4wvzd2
   automated match to d4tlfd_
   complexed with fe2

Details for d4wvzc1

PDB Entry: 4wvz, 2.09 Å

PDB Description: crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa

PDB Compounds: (C:) Thiol dioxygenase

SCOPe Domain Sequences for d4wvzc1:

Sequence; same for both SEQRES and ATOM records:

>d4wvzc1 b.82.1.19 (C:4-201) automated matches {Pseudomonas aeruginosa [TaxId: 1402521]}
ilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqqy
llhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphpsgar
rrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfisg
ysnsrlpniwdlskenpa

Timeline for d4wvzc1:

• d4wvzc1 first appeared in SCOPe 2.06
  
• d4wvzc1 appears in the current release, SCOPe 2.08