Lineage for d3weoa4 (3weo A:757-909)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089028Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2089029Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2089030Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins)
  6. 2089031Protein Maltase, C-terminal domain [310755] (1 species)
  7. 2089032Species Beta vulgaris [TaxId:161934] [311010] (6 PDB entries)
  8. 2089033Domain d3weoa4: 3weo A:757-909 [306748]
    Other proteins in same PDB: d3weoa1, d3weoa2, d3weoa3
    automated match to d3w38a4
    complexed with gol, nag, so4

Details for d3weoa4

PDB Entry: 3weo (more details), 1.45 Å

PDB Description: sugar beet alpha-glucosidase with acarviosyl-maltohexaose
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3weoa4:

Sequence, based on SEQRES records: (download)

>d3weoa4 b.150.1.1 (A:757-909) Maltase, C-terminal domain {Beta vulgaris [TaxId: 161934]}
gnivamqgeamttqaarstpfhllvvmsdhvastgelfldngiemdiggpggkwtlvrff
aesginnltissevvnrgyamsqrwvmdkitilglkrrvrikeytvqkdagaikikglgl
rtsshnqggfvvsvisdlrqlvgqafklelefe

Sequence, based on observed residues (ATOM records): (download)

>d3weoa4 b.150.1.1 (A:757-909) Maltase, C-terminal domain {Beta vulgaris [TaxId: 161934]}
gnivamqgeamttqaarstpfhllvvmsdhvastgelfldngiemdiggpggkwtlvrff
aesginnltissevvnrgyamsqrwvmdkitilglkrrvrikgfvvsvisdlrqlvgqaf
klelefe

SCOPe Domain Coordinates for d3weoa4:

Click to download the PDB-style file with coordinates for d3weoa4.
(The format of our PDB-style files is described here.)

Timeline for d3weoa4: