SCOPe 2.06: Domain d3weoa3: 3weo A:673-756

Lineage for d3weoa3 (3weo A:673-756)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (3 proteins)

6. Protein Maltase, domain 3 [310753] (1 species)

7. Species Beta vulgaris [TaxId:161934] [311008] (6 PDB entries)

8. Domain d3weoa3: 3weo A:673-756 [306747]
   Other proteins in same PDB: d3weoa1, d3weoa2, d3weoa4
   automated match to d3w38a3
   complexed with gol, nag, so4

Details for d3weoa3

PDB Entry: 3weo, 1.45 Å

PDB Description: sugar beet alpha-glucosidase with acarviosyl-maltohexaose

PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3weoa3:

Sequence; same for both SEQRES and ATOM records:

>d3weoa3 b.71.1.4 (A:673-756) Maltase, domain 3 {Beta vulgaris [TaxId: 161934]}
piarplfftfpddvatygissqfligrgimvspvlqpgavsvnayfprgnwfslfnytss
vsvsagtyvslsappdhinvhihe

Timeline for d3weoa3:

• d3weoa3 is new in SCOPe 2.06-stable
  
• d3weoa3 appears in SCOPe 2.07
  
• d3weoa3 appears in the current release, SCOPe 2.08