SCOPe 2.06: Domain d3weoa2: 3weo A:300-672

Lineage for d3weoa2 (3weo A:300-672)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
   Pfam PF01055

6. Protein Maltase, catalytic domain [310751] (1 species)

7. Species Beta vulgaris [TaxId:161934] [311006] (6 PDB entries)

8. Domain d3weoa2: 3weo A:300-672 [306746]
   Other proteins in same PDB: d3weoa1, d3weoa3, d3weoa4
   automated match to d3w38a2
   complexed with gol, nag, so4

Details for d3weoa2

PDB Entry: 3weo, 1.45 Å

PDB Description: sugar beet alpha-glucosidase with acarviosyl-maltohexaose

PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3weoa2:

Sequence; same for both SEQRES and ATOM records:

>d3weoa2 c.1.8.13 (A:300-672) Maltase, catalytic domain {Beta vulgaris [TaxId: 161934]}
pemvldqytkligrpapmpywafgfhqcrwgyrdvneietvvdkyaeariplevmwtdid
ymdafkdftldpvhfpldkmqqfvtklhrngqryvpildpgintnksygtfirgmqsnvf
ikrdgnpylgsvwpgpvyypdfldpaarsfwvdeikrfrdilpidgiwidmneasnfits
aptpgstldnppykinnsggrvpinsktipatamhygnvteynahnlygflesqatreal
vrtsnerpfllsrstfagsgkytahwtgdnaarwddlqysiptmlnfglfgmpmigadic
gfaestteelcrrwiqlgafypfsrdhsardtthqelylwesvaasartvlglryqllpy
yytlmydanlrgi

Timeline for d3weoa2:

• d3weoa2 is new in SCOPe 2.06-stable
  
• d3weoa2 appears in SCOPe 2.07
  
• d3weoa2 appears in the current release, SCOPe 2.08