Lineage for d3r4eb1 (3r4e B:1-111)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555249Species Novosphingobium aromaticivorans [TaxId:279238] [267958] (3 PDB entries)
  8. 2555256Domain d3r4eb1: 3r4e B:1-111 [306417]
    Other proteins in same PDB: d3r4ea2, d3r4ea3, d3r4eb2, d3r4ec2, d3r4ed2
    automated match to d4k8ga1
    complexed with cs2, mg; mutant

Details for d3r4eb1

PDB Entry: 3r4e (more details), 1.65 Å

PDB Description: Crystal structure of the A314P mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with MG and D-mannonate
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3r4eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r4eb1 d.54.1.0 (B:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg

SCOPe Domain Coordinates for d3r4eb1:

Click to download the PDB-style file with coordinates for d3r4eb1.
(The format of our PDB-style files is described here.)

Timeline for d3r4eb1: