Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:279238] [267958] (3 PDB entries) |
Domain d3r4ed1: 3r4e D:1-111 [306421] Other proteins in same PDB: d3r4ea2, d3r4ea3, d3r4eb2, d3r4ec2, d3r4ed2 automated match to d4k8ga1 complexed with cs2, mg; mutant |
PDB Entry: 3r4e (more details), 1.65 Å
SCOPe Domain Sequences for d3r4ed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r4ed1 d.54.1.0 (D:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg
Timeline for d3r4ed1: