Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:279238] [267959] (3 PDB entries) |
Domain d3r4eb2: 3r4e B:112-402 [306418] Other proteins in same PDB: d3r4ea1, d3r4ea3, d3r4eb1, d3r4ec1, d3r4ed1 automated match to d4k8ga2 complexed with cs2, mg; mutant |
PDB Entry: 3r4e (more details), 1.65 Å
SCOPe Domain Sequences for d3r4eb2:
Sequence, based on SEQRES records: (download)
>d3r4eb2 c.1.11.0 (B:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepa daslpsvtgwdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyq lfwledctpaenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagg lthlrriadlaslyqvrtgchgptdlspvtmgcalhfdtwvpnfgiqeymrhteetdavf phdywfekgelfvgetpghgvdideelaakypykpaylpvarledgtmwnw
>d3r4eb2 c.1.11.0 (B:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgislpsvtgwdtrkalny vpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafrl vrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvrt gchgptdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetpg hgvdideelaakypykpaylpvarledgtmwnw
Timeline for d3r4eb2: