SCOPe 2.08: Domain d3r4eb1: 3r4e B:1-111

Lineage for d3r4eb1 (3r4e B:1-111)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [267958] (3 PDB entries)

8. Domain d3r4eb1: 3r4e B:1-111 [306417]
   Other proteins in same PDB: d3r4ea2, d3r4ea3, d3r4eb2, d3r4ec2, d3r4ed2
   automated match to d4k8ga1
   complexed with cs2, mg; mutant

Details for d3r4eb1

PDB Entry: 3r4e, 1.65 Å

PDB Description: Crystal structure of the A314P mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with MG and D-mannonate

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3r4eb1:

Sequence; same for both SEQRES and ATOM records:

>d3r4eb1 d.54.1.0 (B:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg

Timeline for d3r4eb1:

• d3r4eb1 first appeared in SCOPe 2.06
  
• d3r4eb1 appears in SCOPe 2.07