Lineage for d2volb1 (2vol B:9-186)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780523Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 2780548Protein automated matches [190921] (2 species)
    not a true protein
  7. 2780551Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries)
  8. 2780554Domain d2volb1: 2vol B:9-186 [304554]
    Other proteins in same PDB: d2vola1, d2vola2, d2volb2
    automated match to d3zo0b_
    protein/DNA complex; protein/RNA complex; complexed with fuc

Details for d2volb1

PDB Entry: 2vol (more details), 1.95 Å

PDB Description: Murine TRIM21 in Complex with Murine IgG Fc
PDB Compounds: (B:) 52 kda ro protein

SCOPe Domain Sequences for d2volb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2volb1 b.29.1.22 (B:9-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmywev
dvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppcqi
gifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl

SCOPe Domain Coordinates for d2volb1:

Click to download the PDB-style file with coordinates for d2volb1.
(The format of our PDB-style files is described here.)

Timeline for d2volb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2volb2