Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.22: SPRY domain [141154] (6 proteins) Pfam PF00622 |
Protein automated matches [190921] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries) |
Domain d2volb1: 2vol B:9-186 [304554] Other proteins in same PDB: d2vola1, d2vola2, d2volb2 automated match to d3zo0b_ protein/DNA complex; protein/RNA complex; complexed with fuc |
PDB Entry: 2vol (more details), 1.95 Å
SCOPe Domain Sequences for d2volb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2volb1 b.29.1.22 (B:9-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmywev dvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppcqi gifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl
Timeline for d2volb1: