SCOPe 2.06: Domain d2volb1: 2vol B:9-186

Lineage for d2volb1 (2vol B:9-186)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.22: SPRY domain [141154] (6 proteins)
   Pfam PF00622

6. Protein automated matches [190921] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries)

8. Domain d2volb1: 2vol B:9-186 [304554]
   Other proteins in same PDB: d2vola1, d2vola2, d2volb2
   automated match to d3zo0b_
   protein/DNA complex; protein/RNA complex; complexed with fuc

Details for d2volb1

PDB Entry: 2vol, 1.95 Å

PDB Description: Murine TRIM21 in Complex with Murine IgG Fc

PDB Compounds: (B:) 52 kda ro protein

SCOPe Domain Sequences for d2volb1:

Sequence; same for both SEQRES and ATOM records:

>d2volb1 b.29.1.22 (B:9-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmywev
dvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppcqi
gifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl

Timeline for d2volb1:

• d2volb1 is new in SCOPe 2.06-stable
  
• d2volb1 appears in SCOPe 2.07
  
• d2volb1 appears in the current release, SCOPe 2.08