Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (11 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [311230] (2 PDB entries) |
Domain d2nzgm_: 2nzg M: [304250] automated match to d1djrd_ |
PDB Entry: 2nzg (more details), 1.94 Å
SCOPe Domain Sequences for d2nzgm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzgm_ b.40.2.1 (M:) automated matches {Vibrio cholerae [TaxId: 666]} apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma
Timeline for d2nzgm_: