Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [190915] (12 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [311222] (2 PDB entries) |
Domain d2lxka_: 2lxk A: [304189] automated match to d3cama_ |
PDB Entry: 2lxk (more details)
SCOPe Domain Sequences for d2lxka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lxka_ b.40.4.5 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]} meqgtvkwfnaekgfgfierengddvfvhfsaiqgdgfksldegqavtfdveegqrgpqa anvqka
Timeline for d2lxka_: