SCOPe 2.08: Domain d1vjjb5: 1vjj B:1-140

Lineage for d1vjjb5 (1vjj B:1-140)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)

6. Protein Transglutaminase N-terminal domain [49235] (4 species)
   elaborated with many loop insertions in the common fold

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (9 PDB entries)

8. Domain d1vjjb5: 1vjj B:1-140 [303239]
   Other proteins in same PDB: d1vjja6, d1vjja7, d1vjja8, d1vjjb6, d1vjjb7, d1vjjb8
   automated match to d1l9na1
   complexed with ca, cl, gdp, mg

Details for d1vjjb5

PDB Entry: 1vjj, 1.9 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium

PDB Compounds: (B:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1vjjb5:

Sequence; same for both SEQRES and ATOM records:

>d1vjjb5 b.1.18.9 (B:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

Timeline for d1vjjb5:

• d1vjjb5 first appeared in SCOPe 2.06
  
• d1vjjb5 appears in SCOPe 2.07