Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein D-2-hydroxyisocaproate dehydrogenase [51835] (1 species) |
Species Lactobacillus casei [TaxId:1582] [51836] (1 PDB entry) |
Domain d1dxya1: 1dxy A:101-299 [30094] Other proteins in same PDB: d1dxya2 complexed with coi, nad, so4 |
PDB Entry: 1dxy (more details), 1.86 Å
SCOPe Domain Sequences for d1dxya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} spaaiaefaltdtlyllrnmgkvqaqlqagdyekagtfigkelgqqtvgvmgtghigqva iklfkgfgakviaydpypmkgdhpdfdyvsledlfkqsdvidlhvpgieqnthiineaaf nlmkpgaivintarpnlidtqamlsnlksgklagvgidtyeyetedllnlakhgsfkdpl wdellgmpnvvlsphiayy
Timeline for d1dxya1: