SCOPe 2.08: Domain d1dxya1: 1dxy A:101-299

Lineage for d1dxya1 (1dxy A:101-299)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein D-2-hydroxyisocaproate dehydrogenase [51835] (1 species)

7. Species Lactobacillus casei [TaxId:1582] [51836] (1 PDB entry)

8. Domain d1dxya1: 1dxy A:101-299 [30094]
   Other proteins in same PDB: d1dxya2
   complexed with coi, nad, so4

Details for d1dxya1

PDB Entry: 1dxy, 1.86 Å

PDB Description: structure of d-2-hydroxyisocaproate dehydrogenase

PDB Compounds: (A:) d-2-hydroxyisocaproate dehydrogenase

SCOPe Domain Sequences for d1dxya1:

Sequence; same for both SEQRES and ATOM records:

>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
spaaiaefaltdtlyllrnmgkvqaqlqagdyekagtfigkelgqqtvgvmgtghigqva
iklfkgfgakviaydpypmkgdhpdfdyvsledlfkqsdvidlhvpgieqnthiineaaf
nlmkpgaivintarpnlidtqamlsnlksgklagvgidtyeyetedllnlakhgsfkdpl
wdellgmpnvvlsphiayy

Timeline for d1dxya1:

• d1dxya1 first appeared (with stable ids) in SCOP 1.55, called d1dxy_1
  
• d1dxya1 appears in SCOPe 2.07