Lineage for d1dxy_1 (1dxy 101-299)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (8 proteins) 
Protein D-2-hydroxyisocaproate dehydrogenase [51835] (1 species) Species Lactobacillus casei [TaxId:1582] [51836] (1 PDB entry) 
Domain d1dxy_1: 1dxy 101-299 [30094]
Other proteins in same PDB: d1dxy_2
Details for d1dxy_1
PDB Entry: 1dxy (more details), 1.9 Å
PDB Description: structure of d-2-hydroxyisocaproate dehydrogenase
SCOP Domain Sequences for d1dxy_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxy_1 c.2.1.4 (101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei}
spaaiaefaltdtlyllrnmgkvqaqlqagdyekagtfigkelgqqtvgvmgtghigqva
iklfkgfgakviaydpypmkgdhpdfdyvsledlfkqsdvidlhvpgieqnthiineaaf
nlmkpgaivintarpnlidtqamlsnlksgklagvgidtyeyetedllnlakhgsfkdpl
wdellgmpnvvlsphiayy
SCOP Domain Coordinates for d1dxy_1:
Click to download the PDB-style file with coordinates for d1dxy_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dxy_1:
- d1dxy_1 appears in SCOP 1.57
- d1dxy_1 appears in the current release, SCOPe 2.08, called d1dxya1
View in 3D
