![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
![]() | Protein D-2-hydroxyisocaproate dehydrogenase [52289] (1 species) |
![]() | Species Lactobacillus casei [TaxId:1582] [52290] (1 PDB entry) |
![]() | Domain d1dxya2: 1dxy A:1-100,A:300-330 [31354] Other proteins in same PDB: d1dxya1 complexed with coi, nad, so4 |
PDB Entry: 1dxy (more details), 1.86 Å
SCOPe Domain Sequences for d1dxya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} mkiiaygarvdeiqyfkqwakdtgntleyhtefldentvewakgfdginslqttpyaagv fekmhaygikfltirnvgtdnidmtamkqygirlsnvpayXtetavhnmvyfslqhlvdf ltkgetstevtg
Timeline for d1dxya2: