SCOPe 2.08: Domain d1dxya2: 1dxy A:1-100,A:300-330

Lineage for d1dxya2 (1dxy A:1-100,A:300-330)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
   this domain is interrupted by the Rossmann-fold domain

6. Protein D-2-hydroxyisocaproate dehydrogenase [52289] (1 species)

7. Species Lactobacillus casei [TaxId:1582] [52290] (1 PDB entry)

8. Domain d1dxya2: 1dxy A:1-100,A:300-330 [31354]
   Other proteins in same PDB: d1dxya1
   complexed with coi, nad, so4

Details for d1dxya2

PDB Entry: 1dxy, 1.86 Å

PDB Description: structure of d-2-hydroxyisocaproate dehydrogenase

PDB Compounds: (A:) d-2-hydroxyisocaproate dehydrogenase

SCOPe Domain Sequences for d1dxya2:

Sequence; same for both SEQRES and ATOM records:

>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
mkiiaygarvdeiqyfkqwakdtgntleyhtefldentvewakgfdginslqttpyaagv
fekmhaygikfltirnvgtdnidmtamkqygirlsnvpayXtetavhnmvyfslqhlvdf
ltkgetstevtg

Timeline for d1dxya2:

• d1dxya2 first appeared (with stable ids) in SCOP 1.55, called d1dxy_2
  
• d1dxya2 appears in SCOPe 2.07