SCOPe 2.08: Domain d2bggb3: 2bgg B:171-427

Lineage for d2bggb3 (2bgg B:171-427)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.15: PIWI domain C-terminal [310608] (4 proteins)
   PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1)

6. Protein Hypothetical protein AF1318 [310687] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [310904] (3 PDB entries)

8. Domain d2bggb3: 2bgg B:171-427 [285430]
   Other proteins in same PDB: d2bgga2, d2bggb2
   protein/RNA complex; complexed with mn

Details for d2bggb3

PDB Entry: 2bgg, 2.2 Å

PDB Description: the structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt sirna duplex.

PDB Compounds: (B:) protein af1318

SCOPe Domain Sequences for d2bggb3:

Sequence, based on SEQRES records:

>d2bggb3 c.55.3.15 (B:171-427) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
lnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylksti
kkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyail
hlnethpfwvmgdpnnrfhpyegtkvklsskrylltllqpylkrnglemvtpikplsvei
vsdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggy
pinpegnrslqtnpwfl

Sequence, based on observed residues (ATOM records):

>d2bggb3 c.55.3.15 (B:171-427) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
lnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylksti
kkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyail
hlnethpfwvmgtkvklsskrylltllqvtpikplsveivsdnwtseeyyhnvheildei
yylskmnwrgfrsrnlpvtvnypklvagiianvnryggypinpegnrslqtnpwfl

Timeline for d2bggb3:

• d2bggb3 first appeared in SCOPe 2.06
  
• d2bggb3 appears in SCOPe 2.07