SCOPe 2.08: Domain d2bgga2: 2bgg A:11-170

Lineage for d2bgga2 (2bgg A:11-170)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families)

5. Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins)
   PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10)

6. Protein Hypothetical protein AF1318 [310688] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [310905] (3 PDB entries)

8. Domain d2bgga2: 2bgg A:11-170 [285427]
   Other proteins in same PDB: d2bgga3, d2bggb3
   protein/RNA complex; complexed with mn

Details for d2bgga2

PDB Entry: 2bgg, 2.2 Å

PDB Description: the structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt sirna duplex.

PDB Compounds: (A:) protein af1318

SCOPe Domain Sequences for d2bgga2:

Sequence; same for both SEQRES and ATOM records:

>d2bgga2 c.44.3.1 (A:11-170) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
ltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfsslinqlksqiss
kidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeyntplyyklksyl
insipsqfmrydilsnrnltfyvdnllvqfvsklggkpwi

Timeline for d2bgga2:

• d2bgga2 first appeared in SCOPe 2.06
  
• d2bgga2 appears in SCOPe 2.07