SCOPe 2.08: Domain d2n6ga1: 2n6g A:6-80

Lineage for d2n6ga1 (2n6g A:6-80)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.2: MbtH-like [160582] (2 families)
   the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position

5. Family d.100.2.0: automated matches [254253] (1 protein)
   not a true family

6. Protein automated matches [254578] (8 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:243243] [280169] (1 PDB entry)

8. Domain d2n6ga1: 2n6g A:6-80 [280170]
   Other proteins in same PDB: d2n6ga2
   automated match to d2khra_

Details for d2n6ga1

PDB Entry: 2n6g

PDB Description: solution structure of an mbth-like protein from mycobacterium avium, seattle structural genomics center for infectious disease target myava.01649.c

PDB Compounds: (A:) MbtH-like protein

SCOPe Domain Sequences for d2n6ga1:

Sequence; same for both SEQRES and ATOM records:

>d2n6ga1 d.100.2.0 (A:6-80) automated matches {Mycobacterium avium [TaxId: 243243]}
sinpfdddngsffvlvndeeqhslwpafadvpagwrvvhgeadraacleyieehwpdirp
kslrdklatgrgfdq

Timeline for d2n6ga1:

• d2n6ga1 first appeared in SCOPe 2.05, called d2n6ga_
  
• d2n6ga1 appears in SCOPe 2.07