SCOPe 2.05: Domain d2n6ga_: 2n6g A:

Lineage for d2n6ga_ (2n6g A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.2: MbtH-like [160582] (2 families)
   the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position

5. Family d.100.2.0: automated matches [254253] (1 protein)
   not a true family

6. Protein automated matches [254578] (3 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:243243] [280169] (1 PDB entry)

8. Domain d2n6ga_: 2n6g A: [280170]
   automated match to d2khra_

Details for d2n6ga_

PDB Entry: 2n6g

PDB Description: solution structure of an mbth-like protein from mycobacterium avium, seattle structural genomics center for infectious disease target myava.01649.c

PDB Compounds: (A:) MbtH-like protein

SCOPe Domain Sequences for d2n6ga_:

Sequence; same for both SEQRES and ATOM records:

>d2n6ga_ d.100.2.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}
gpgsmsinpfdddngsffvlvndeeqhslwpafadvpagwrvvhgeadraacleyieehw
pdirpkslrdklatgrgfdq

Timeline for d2n6ga_:

• d2n6ga_ is new in SCOPe 2.05-stable
  
• d2n6ga_ is called d2n6ga1 in SCOPe 2.06
  
• d2n6ga_ appears in the current release, SCOPe 2.08, called d2n6ga1