Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.100.2: MbtH-like [160582] (2 families) the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position |
Family d.100.2.0: automated matches [254253] (1 protein) not a true family |
Protein automated matches [254578] (3 species) not a true protein |
Species Mycobacterium avium [TaxId:243243] [280169] (1 PDB entry) |
Domain d2n6ga_: 2n6g A: [280170] automated match to d2khra_ |
PDB Entry: 2n6g (more details)
SCOPe Domain Sequences for d2n6ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n6ga_ d.100.2.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]} gpgsmsinpfdddngsffvlvndeeqhslwpafadvpagwrvvhgeadraacleyieehw pdirpkslrdklatgrgfdq
Timeline for d2n6ga_: