PDB entry 2n6g

View 2n6g on RCSB PDB site
Description: Solution structure of an MbtH-like protein from Mycobacterium avium, Seattle Structural Genomics Center for Infectious Disease target MyavA.01649.c
Class: unknown function
Keywords: SSGCID, tuberculosis, infectious diseases, mbtH-like, UNKNOWN FUNCTION
Deposited on 2015-08-20, released 2015-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-30, with a file datestamp of 2015-12-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MbtH-like protein
    Species: Mycobacterium avium 104 [TaxId:243243]
    Database cross-references and differences (RAF-indexed):
    • PDB 2N6G (0-79)
    Domains in SCOPe 2.08: d2n6ga1, d2n6ga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n6gA (A:)
gpgsmsinpfdddngsffvlvndeeqhslwpafadvpagwrvvhgeadraacleyieehw
pdirpkslrdklatgrgfdq