Lineage for d4ro0o2 (4ro0 O:245-336)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2241850Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 2241851Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 2241882Family d.286.1.0: automated matches [228502] (1 protein)
    not a true family
  6. 2241883Protein automated matches [228504] (1 species)
    not a true protein
  7. 2241884Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)
  8. 2241939Domain d4ro0o2: 4ro0 O:245-336 [278748]
    Other proteins in same PDB: d4ro0a1, d4ro0b1, d4ro0c1, d4ro0d1, d4ro0e1, d4ro0f1, d4ro0g1, d4ro0h1, d4ro0i1, d4ro0j1, d4ro0k1, d4ro0l1, d4ro0m1, d4ro0n1, d4ro0o1, d4ro0p1, d4ro0q1, d4ro0r1, d4ro0s1, d4ro0t1
    automated match to d2aema2

Details for d4ro0o2

PDB Entry: 4ro0 (more details), 3.18 Å

PDB Description: crystal structure of mthk gating ring in a ligand-free form
PDB Compounds: (O:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4ro0o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ro0o2 d.286.1.0 (O:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOPe Domain Coordinates for d4ro0o2:

Click to download the PDB-style file with coordinates for d4ro0o2.
(The format of our PDB-style files is described here.)

Timeline for d4ro0o2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ro0o1