Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily) beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold |
Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) |
Family d.286.1.0: automated matches [228502] (1 protein) not a true family |
Protein automated matches [228504] (1 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries) |
Domain d4ro0s2: 4ro0 S:245-336 [278744] Other proteins in same PDB: d4ro0a1, d4ro0b1, d4ro0c1, d4ro0d1, d4ro0e1, d4ro0f1, d4ro0g1, d4ro0h1, d4ro0i1, d4ro0j1, d4ro0k1, d4ro0l1, d4ro0m1, d4ro0n1, d4ro0o1, d4ro0p1, d4ro0q1, d4ro0r1, d4ro0s1, d4ro0t1 automated match to d2aema2 |
PDB Entry: 4ro0 (more details), 3.18 Å
SCOPe Domain Sequences for d4ro0s2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ro0s2 d.286.1.0 (S:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii dpprdysfragdiilgigkpeeierlknyisa
Timeline for d4ro0s2:
View in 3D Domains from other chains: (mouse over for more information) d4ro0a1, d4ro0a2, d4ro0b1, d4ro0b2, d4ro0c1, d4ro0c2, d4ro0d1, d4ro0d2, d4ro0e1, d4ro0e2, d4ro0f1, d4ro0f2, d4ro0g1, d4ro0g2, d4ro0h1, d4ro0h2, d4ro0i1, d4ro0i2, d4ro0j1, d4ro0j2, d4ro0k1, d4ro0k2, d4ro0l1, d4ro0l2, d4ro0m1, d4ro0m2, d4ro0n1, d4ro0n2, d4ro0o1, d4ro0o2, d4ro0p1, d4ro0p2, d4ro0q1, d4ro0q2, d4ro0r1, d4ro0r2, d4ro0t1, d4ro0t2 |