Lineage for d4ro0h1 (4ro0 H:116-244)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106641Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
    automatically mapped to Pfam PF02254
  6. 2106691Protein automated matches [228498] (1 species)
    not a true protein
  7. 2106692Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries)
  8. 2106740Domain d4ro0h1: 4ro0 H:116-244 [278734]
    Other proteins in same PDB: d4ro0a2, d4ro0b2, d4ro0c2, d4ro0d2, d4ro0e2, d4ro0f2, d4ro0g2, d4ro0h2, d4ro0i2, d4ro0j2, d4ro0k2, d4ro0l2, d4ro0m2, d4ro0n2, d4ro0o2, d4ro0p2, d4ro0q2, d4ro0r2, d4ro0s2, d4ro0t2
    automated match to d2aema1

Details for d4ro0h1

PDB Entry: 4ro0 (more details), 3.18 Å

PDB Description: crystal structure of mthk gating ring in a ligand-free form
PDB Compounds: (H:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4ro0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ro0h1 c.2.1.9 (H:116-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsid

SCOPe Domain Coordinates for d4ro0h1:

Click to download the PDB-style file with coordinates for d4ro0h1.
(The format of our PDB-style files is described here.)

Timeline for d4ro0h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ro0h2