SCOPe 2.08: Domain d5d71l2: 5d71 L:109-209

Lineage for d5d71l2 (5d71 L:109-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5d71l2: 5d71 L:109-209 [278082]
   Other proteins in same PDB: d5d71a1, d5d71a2
   automated match to d3s96b2
   complexed with peg, so4

Details for d5d71l2

PDB Entry: 5d71, 2.25 Å

PDB Description: crystal structure of mor04302, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf

PDB Compounds: (L:) Immunglobulin G1 Fab fragment, light chain

SCOPe Domain Sequences for d5d71l2:

Sequence; same for both SEQRES and ATOM records:

>d5d71l2 b.1.1.0 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d5d71l2:

• d5d71l2 first appeared in SCOPe 2.05
  
• d5d71l2 appears in SCOPe 2.07