Lineage for d2taaa1 (2taa A:382-478)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810567Protein Fungal alpha-amylase [51028] (2 species)
  7. 2810570Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries)
  8. 2810579Domain d2taaa1: 2taa A:382-478 [27780]
    Other proteins in same PDB: d2taaa2, d2taab2, d2taac2
    complexed with ca

Details for d2taaa1

PDB Entry: 2taa (more details), 3 Å

PDB Description: structure and possible catalytic residues of taka-amylase a
PDB Compounds: (A:) taka-amylase a

SCOPe Domain Sequences for d2taaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2taaa1 b.71.1.1 (A:382-478) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknpyikddttiamrkgtdgsqivtilsnkgasgdsytlslsgasytagqqltevigctt
vtvgsdgnvpvpmagglprvlypteklagskicsdss

SCOPe Domain Coordinates for d2taaa1:

Click to download the PDB-style file with coordinates for d2taaa1.
(The format of our PDB-style files is described here.)

Timeline for d2taaa1: