SCOPe 2.08: Domain d2taab1: 2taa B:382-478

Lineage for d2taab1 (2taa B:382-478)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Fungal alpha-amylase [51028] (2 species)

7. Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries)

8. Domain d2taab1: 2taa B:382-478 [118672]
   Other proteins in same PDB: d2taaa2, d2taab2, d2taac2
   duplicate of 2TAA A:382-478
   complexed with ca

Details for d2taab1

PDB Entry: 2taa, 3 Å

PDB Description: structure and possible catalytic residues of taka-amylase a

PDB Compounds: (B:) taka-amylase a

SCOPe Domain Sequences for d2taab1:

Sequence; same for both SEQRES and ATOM records:

>d2taab1 b.71.1.1 (B:382-478) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknpyikddttiamrkgtdgsqivtilsnkgasgdsytlslsgasytagqqltevigctt
vtvgsdgnvpvpmagglprvlypteklagskicsdss

Timeline for d2taab1:

• d2taab1 first appeared in SCOP 1.73
  
• d2taab1 appears in SCOPe 2.07