SCOPe 2.08: Domain d1osea1: 1ose A:404-496

Lineage for d1osea1 (1ose A:404-496)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries)

8. Domain d1osea1: 1ose A:404-496 [27766]
   Other proteins in same PDB: d1osea2
   complexed with bgc, ca, cl

Details for d1osea1

PDB Entry: 1ose, 2.3 Å

PDB Description: porcine pancreatic alpha-amylase complexed with acarbose

PDB Compounds: (A:) porcine alpha-amylase

SCOPe Domain Sequences for d1osea1:

Sequence; same for both SEQRES and ATOM records:

>d1osea1 b.71.1.1 (A:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1osea1:

• d1osea1 first appeared (with stable ids) in SCOP 1.55, called d1ose_1
  
• d1osea1 appears in SCOPe 2.07