Lineage for d1ose_1 (1ose 404-496)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17291Protein Animal alpha-amylase [51024] (3 species)
  7. 17298Species Pig (Sus scrofa) [TaxId:9823] [51025] (7 PDB entries)
  8. 17304Domain d1ose_1: 1ose 404-496 [27766]
    Other proteins in same PDB: d1ose_2

Details for d1ose_1

PDB Entry: 1ose (more details), 2.3 Å

PDB Description: porcine pancreatic alpha-amylase complexed with acarbose

SCOP Domain Sequences for d1ose_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ose_1 b.71.1.1 (404-496) Animal alpha-amylase {Pig (Sus scrofa)}
epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1ose_1:

Click to download the PDB-style file with coordinates for d1ose_1.
(The format of our PDB-style files is described here.)

Timeline for d1ose_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ose_2