| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
| Species Bacillus stearothermophilus [TaxId:1422] [51020] (1 PDB entry) |
| Domain d1cyga3: 1cyg A:403-491 [27750] Other proteins in same PDB: d1cyga1, d1cyga2, d1cyga4 complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1cyg (more details), 2.5 Å
SCOPe Domain Sequences for d1cyga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyga3 b.71.1.1 (A:403-491) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
gdteqrwingdvyvyerqfgkdvvlvavnrssssnysitglftalpagtytdqlgglldg
ntiqvgsngsvnafdlgpgevgvwaysat
Timeline for d1cyga3: