SCOPe 2.05: Domain d4zbya_: 4zby A:

Lineage for d4zbya_ (4zby A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.0: automated matches [193165] (1 protein)
   not a true family

6. Protein automated matches [193166] (6 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [277049] (3 PDB entries)

8. Domain d4zbya_: 4zby A: [277050]
   automated match to d1vk2a_
   protein/DNA complex; complexed with mes, sf4, ura

Details for d4zbya_

PDB Entry: 4zby, 1.7 Å

PDB Description: family 4 uracil-dna glycosylase from sulfolobus tokodaii (uracil complex form)

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4zbya_:

Sequence; same for both SEQRES and ATOM records:

>d4zbya_ c.18.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mdslekikeevisckkcklwqfrtnavpgegypkaeimfvgeapgenedkegrpfvgaag
klltqmikeilglerdqvfitnvvkcrppnnrdpeedeitacspyldrqidiimpkiivt
lgrhstkyifskmgenfssitkvrgksyvwkykekeiivfptyhpaaalynpnlrkilee
dfkkirelaitpkr

Timeline for d4zbya_:

• d4zbya_ is new in SCOPe 2.05-stable
  
• d4zbya_ appears in SCOPe 2.06
  
• d4zbya_ appears in the current release, SCOPe 2.08