Lineage for d4zbya_ (4zby A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114317Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2114318Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2114425Family c.18.1.0: automated matches [193165] (1 protein)
    not a true family
  6. 2114426Protein automated matches [193166] (6 species)
    not a true protein
  7. 2114464Species Sulfolobus tokodaii [TaxId:273063] [277049] (3 PDB entries)
  8. 2114466Domain d4zbya_: 4zby A: [277050]
    automated match to d1vk2a_
    protein/DNA complex; complexed with mes, sf4, ura

Details for d4zbya_

PDB Entry: 4zby (more details), 1.7 Å

PDB Description: family 4 uracil-dna glycosylase from sulfolobus tokodaii (uracil complex form)
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4zbya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zbya_ c.18.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mdslekikeevisckkcklwqfrtnavpgegypkaeimfvgeapgenedkegrpfvgaag
klltqmikeilglerdqvfitnvvkcrppnnrdpeedeitacspyldrqidiimpkiivt
lgrhstkyifskmgenfssitkvrgksyvwkykekeiivfptyhpaaalynpnlrkilee
dfkkirelaitpkr

SCOPe Domain Coordinates for d4zbya_:

Click to download the PDB-style file with coordinates for d4zbya_.
(The format of our PDB-style files is described here.)

Timeline for d4zbya_: